Protein Info for OKFHMN_15100 in Escherichia coli ECRC101

Name: yidL
Annotation: Uncharacterized HTH-type transcriptional regulator YidL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 157 to 175 (19 residues), see Phobius details PF02311: AraC_binding" amino acids 65 to 129 (65 residues), 28.8 bits, see alignment E=1.4e-10 PF12833: HTH_18" amino acids 207 to 284 (78 residues), 62.9 bits, see alignment E=4.4e-21 PF00165: HTH_AraC" amino acids 245 to 283 (39 residues), 38.4 bits, see alignment 1.6e-13

Best Hits

Swiss-Prot: 99% identical to YIDL_ECOLI: Uncharacterized HTH-type transcriptional regulator YidL (yidL) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b3680)

Predicted SEED Role

"Hypothetical transcriptional regulator yidL"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>OKFHMN_15100 Uncharacterized HTH-type transcriptional regulator YidL (Escherichia coli ECRC101)
MNGKLQTSDVKNETPYNIPLLINENVISSGISLISLWHTYADEHYRVIWPRDKKKPLIAN
SWVAVYTVQGCGKILLKNGEQITLHGNCIIFLKPMDIHSYHCEGLVWEQYWMEFTPTSMM
DIPIGQQSVIYNGEIYNQELTEVAELITSPEAIKNNLAVAFLTKIIYQWICLMYADGKKD
PQRRQIEKLIATLHASLQQRWSVADMAATIPCSEAWLRRLFLRYTGKTPKEYYLDARLDL
ALSLLKQQGNSVGEVADTLNFFDSFHFSKAFKHKFGYAPSAVLKNTDQHPTDASPHN