Protein Info for OKFHMN_14815 in Escherichia coli ECRC101

Name: atpH
Annotation: F0F1 ATP synthase subunit delta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00213: OSCP
  • amino acids 7 to 174 (168 residues), 166.6 bits, E=3e-53
• TIGR01145: ATP synthase F1, delta subunit
  • amino acids 7 to 175 (169 residues), 224.3 bits, E=5.9e-71

Best Hits

Swiss-Prot: 100% identical to ATPD_ECOLI: ATP synthase subunit delta (atpH) from Escherichia coli (strain K12)

KEGG orthology group: K02113, F-type H+-transporting ATPase subunit delta [EC: 3.6.3.14] (inferred from 100% identity to eco:b3735)

MetaCyc: 100% identical to ATP synthase F1 complex subunit delta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP synthase delta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (177 amino acids)

>OKFHMN_14815 F0F1 ATP synthase subunit delta (Escherichia coli ECRC101)
MSEFITVARPYAKAAFDFAVEHQSVERWQDMLAFAAEVTKNEQMAELLSGALAPETLAES
FIAVCGEQLDENGQNLIRVMAENGRLNALPDVLEQFIHLRAVSEATAEVDVISAAALSEQ
QLAKISAAMEKRLSRKVKLNCKIDKSVMAGVIIRAGDMVIDGSVRGRLERLADVLQS