Protein Info for OKFHMN_14035 in Escherichia coli ECRC101

Name: yihS
Annotation: sulfoquinovose isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 413 PF07221: GlcNAc_2-epim" amino acids 32 to 387 (356 residues), 466.5 bits, see alignment E=3.1e-144

Best Hits

Swiss-Prot: 100% identical to SQUS_ECOLI: Sulfoquinovose isomerase (yihS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3880)

MetaCyc: 100% identical to sulfoquinovose isomerase (Escherichia coli K-12 substr. MG1655)
Mannose isomerase. [EC: 5.3.1.7]; RXN-15296 [EC: 5.3.1.7, 5.3.1.31]

Predicted SEED Role

"Aldose-ketose isomerase YihS"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.31 or 5.3.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (413 amino acids)

>OKFHMN_14035 sulfoquinovose isomerase (Escherichia coli ECRC101)
MKWFNTLSHNRWLEQETDRIFDFGKNSVVPTGFGWLGNKGQIKEEMGTHLWITARMLHVY
SVAAAMGRPGAYSLVDHGIKAMNGALRDKKYGGWYACVNDEGVVDASKQGYQHFFALLGA
ASAVTTGHPEARKLLDYTIEIIEKYFWSEEEQMCLESWDEAFSKTEEYRGGNANMHAVEA
FLIVYDVTHDKKWLDRAIRVASVIIHDVARNNHYRVNEHFDTQWNPLPDYNKDNPAHRFR
AFGGTPGHWIEWGRLMLHIHAALEARCEQPPAWLLEDAKGLFNATVRDAWAPDGADGIVY
TVDWEGKPVVRERVRWPIVEAMGTAYALYTVTGDRQYETWYQTWWDYCIKYLMDYENGSW
WQELDADNKVTTKVWDGKQDIYHLLHCLVIPRIPLAPGLAPAVAAGLLDINAK