Protein Info for OKFHMN_13655 in Escherichia coli ECRC101

Name: yijE
Annotation: cystine transporter YijE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 35 to 59 (25 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 183 to 205 (23 residues), see Phobius details amino acids 217 to 239 (23 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 272 to 289 (18 residues), see Phobius details PF00892: EamA" amino acids 11 to 141 (131 residues), 85.6 bits, see alignment E=1.8e-28 amino acids 152 to 289 (138 residues), 90.4 bits, see alignment E=5.7e-30

Best Hits

Swiss-Prot: 100% identical to YIJE_ECOLI: Probable cystine transporter YijE (yijE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b3943)

MetaCyc: 100% identical to cystine exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-267

Predicted SEED Role

"FIG00638276: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>OKFHMN_13655 cystine transporter YijE (Escherichia coli ECRC101)
MSAAGKSNPLAISGLVVLTLIWSYSWIFMKQVTSYIGAFDFTALRCIFGALVLFIVLLLR
GRGMRPTPFKYTLAIALLQTCGMVGLAQWALVSGGAGKVAILSYTMPFWVVIFAAVFLGE
RLRRGQYFAILIAAFGLFLVLQPWQLDFSSMKSAMLAILSGVSWGASAIVAKRLYARHPR
VDLLSLTSWQMLYAALVMSVVALLVPQREIDWQPTVFWALAYSAILATALAWSLWLFVLK
NLPASIASLSTLAVPVCGVLFSWWLLGENPGAVEGSGIVLIVLALALVSRKKKEAVSVKR
I