Protein Info for OKFHMN_13325 in Escherichia coli ECRC100

Name: zraS
Annotation: two-component system sensor histidine kinase ZraS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details PF00512: HisKA" amino acids 238 to 300 (63 residues), 52 bits, see alignment E=5.8e-18 PF02518: HATPase_c" amino acids 346 to 450 (105 residues), 100.1 bits, see alignment E=1.1e-32

Best Hits

Swiss-Prot: 100% identical to ZRAS_ECO57: Sensor protein ZraS (zraS) from Escherichia coli O157:H7

KEGG orthology group: K07709, two-component system, NtrC family, sensor histidine kinase HydH [EC: 2.7.13.3] (inferred from 100% identity to ecf:ECH74115_5473)

MetaCyc: 85% identical to sensor histidine kinase ZraS (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Sensor protein of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>OKFHMN_13325 two-component system sensor histidine kinase ZraS (Escherichia coli ECRC100)
MRFMQRSKDSLAKWLSAILPVVIVGLVGLFAVTVIRDYGRETAAARQTLLEKGSVLIRAL
ESGSRVGMGMRMHHAQQQALLEEMAGQPGVRWFAVTDEQGTIVMHSNSGMVGKQLYSPQE
MQQLHPGDEEVWRRIDSADGEPVLEIYRQFQPMFAAGMHRMRHMQQYAATPQAIFIAFDA
SNIVSAEDREQRNTLIILFALATVLLASVLSFFWYRRYLRSRQLLQDEMKRKEKLVALGH
LAAGVAHEIRNPLSSIKGLAKYFAERAPAGGEAHQLAQVMAKEADRLNRVVSELLELVKP
THLALQAVDLNTLINHSLQLVSQDANCREIQLRFTANDTLPEIQADPDRLTQVLLNLYLN
AIQAIGQHGVISVTASESGAGVKISVTDSGKGIAADQLEAIFTPYFTTKAEGTGLGLAVV
HNIVEQHGGTIQVASLEGKGARFTLWLPVNITRKDPQG