Protein Info for OKFHMN_13195 in Escherichia coli ECRC101

Name: deoR
Annotation: Cro/Cl family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF04545: Sigma70_r4" amino acids 15 to 47 (33 residues), 25.6 bits, see alignment 7.2e-10 PF04198: Sugar-bind" amino acids 58 to 315 (258 residues), 266.6 bits, see alignment E=1.8e-83

Best Hits

Swiss-Prot: 87% identical to SORC_KLEPN: Sorbitol operon regulator (sorC) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 98% identity to sdy:SDY_4311)

Predicted SEED Role

"Putative transcriptional regulator of sorbose uptake and utilization genes" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (315 amino acids)

>OKFHMN_13195 Cro/Cl family transcriptional regulator (Escherichia coli ECRC101)
MENSDDIRLIVKIAQLYYEQDMTQAQIARELGIYRTNISRLLKRGRDQGIVTIAINYDYN
ENLWLEQQLKQKFGLKDVVVVSGNDEDEETQLAMMGLHGAQLLDRLLEPGDIVGFSWGRA
VSALVENLPQAGQSRQLICVPIIGGPSGKLESRYHVNTLTYSAAAKLKGESHLADFPALL
DNPLIRNGIMQSQHFKTISAYWDNLDVALVGIGSPAIRDGANWHAFYGGEESDDLNARQV
AGDICSRFFDIHGEMVETNMSEKTLSIEMNKLKQARYSIGIAMSEEKYSGIIGALRGKYI
NCLVTNSSTAELLLK