Protein Info for OKFHMN_12955 in Escherichia coli ECRC101

Annotation: DinI-like protein Z3916/ECs3483

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 82 PF06183: DinI" amino acids 16 to 80 (65 residues), 66.9 bits, see alignment E=7.9e-23

Best Hits

Swiss-Prot: 98% identical to DINI3_ECO57: DinI-like protein Z3916/ECs3483 (Z3916) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 96% identity to etw:ECSP_2932)

Predicted SEED Role

"DNA-damage-inducible protein I" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (82 amino acids)

>OKFHMN_12955 DinI-like protein Z3916/ECs3483 (Escherichia coli ECRC101)
MRIEICIAKEKMTKMPNGAVDALKEELTRRISKRYDDVEVIVKATSNDGLSVTRTADKDS
AKTFVQETLKDTWESSDEWFVH