Protein Info for OKFHMN_12905 in Escherichia coli ECRC101

Name: yjbQ
Annotation: UPF0047 protein YjbQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 TIGR00149: secondary thiamine-phosphate synthase enzyme" amino acids 4 to 138 (135 residues), 180.1 bits, see alignment E=7.6e-58 PF01894: UPF0047" amino acids 19 to 134 (116 residues), 125 bits, see alignment E=8.9e-41

Best Hits

Swiss-Prot: 100% identical to YJBQ_ECO57: UPF0047 protein YjbQ (yjbQ) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 100% identity to eco:b4056)

Predicted SEED Role

"FIG004064: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>OKFHMN_12905 UPF0047 protein YjbQ (Escherichia coli ECRC101)
MWYQKTLTLSAKSRGFHLVTDEILNQLADMPRVNIGLLHLLLQHTSASLTLNENCDPTVR
HDMERFFLRTVPDNGNYEHDYEGADDMPSHIKSSMLGTSLVLPVHKGRIQTGTWQGIWLG
EHRIHGGSRRIIATLQGE