Protein Info for OKFHMN_11880 in Escherichia coli ECRC101

Name: mgtA
Annotation: magnesium-translocating P-type ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 898 transmembrane" amino acids 90 to 112 (23 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 291 to 309 (19 residues), see Phobius details amino acids 317 to 342 (26 residues), see Phobius details amino acids 704 to 723 (20 residues), see Phobius details amino acids 728 to 747 (20 residues), see Phobius details amino acids 768 to 791 (24 residues), see Phobius details amino acids 803 to 821 (19 residues), see Phobius details amino acids 833 to 855 (23 residues), see Phobius details amino acids 869 to 890 (22 residues), see Phobius details TIGR01524: magnesium-translocating P-type ATPase" amino acids 34 to 898 (865 residues), 1607.2 bits, see alignment E=0 PF00690: Cation_ATPase_N" amino acids 48 to 112 (65 residues), 53.6 bits, see alignment 3.5e-18 TIGR01494: HAD ATPase, P-type, family IC" amino acids 123 to 407 (285 residues), 130 bits, see alignment E=8.6e-42 amino acids 606 to 728 (123 residues), 105.6 bits, see alignment E=2.3e-34 PF00122: E1-E2_ATPase" amino acids 160 to 351 (192 residues), 150.8 bits, see alignment E=7.6e-48 PF00702: Hydrolase" amino acids 368 to 653 (286 residues), 59.8 bits, see alignment E=1.2e-19 PF13246: Cation_ATPase" amino acids 419 to 481 (63 residues), 38.9 bits, see alignment 1.8e-13 PF00689: Cation_ATPase_C" amino acids 722 to 889 (168 residues), 76.1 bits, see alignment E=7.5e-25

Best Hits

Swiss-Prot: 100% identical to ATMA_ECO57: Magnesium-transporting ATPase, P-type 1 (mgtA) from Escherichia coli O157:H7

KEGG orthology group: K01531, Mg2+-importing ATPase [EC: 3.6.3.2] (inferred from 100% identity to eoh:ECO103_5038)

Predicted SEED Role

"Mg(2+) transport ATPase, P-type (EC 3.6.3.2)" (EC 3.6.3.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (898 amino acids)

>OKFHMN_11880 magnesium-translocating P-type ATPase (Escherichia coli ECRC101)
MFKEIFTRLIRHLPSRLVHRDPLPGAQQTVNTVVPPSLSAHCLKMAVMPEEELWKTFDTH
PEGLNQAEVESAREQHGENKLPAQQPSPWWVHLWVCYRNPFNILLTILGAISYATEDLFA
AGVIALMVAISTLLNFIQEARSTKAADALKAMVSNTATVLRVINDKGENGWLEIPIDQLV
PGDIIKLAAGDMIPADLRILQARDLFVAQASLTGESLPVEKAATTRQPEHSNPLECDTLC
FMGTTVVSGTAQAMVIATGANTWFGQLAGRVSEQESEPNAFQQGISRVSMLLIRFMLVMA
PVVLLINGYTKGDWWEAALFALSVAVGLTPEMLPMIVTSTLARGAVKLSKQKVIVKHLDA
IQNFGAMDILCTDKTGTLTQDKIVLENHTDISGKTSERVLHSAWLNSHYQTGLKNLLDTA
VLEGTDEESARSLASRWQKIDEIPFDFERRRMSVVVAENTEHHQLVCKGALQEILNVCSQ
VRHNGEIVPLDDIMLRKIKRVTDTLNRQGLRVVAVATKYLPAREGDYQRADESDLILEGY
IAFLDPPKETTAPALKALKASGITVKILTGDSELVAAKVCHEVGLDAGEVVIGSDIETLS
DDELANLAQRTTLFARLTPMHKERIVTLLKREGHVVGFMGDGINDAPALRAADIGISVDG
AVDIAREAADIILLEKSLMVLEEGVIEGRRTFANMLKYIKMTASSNFGNVFSVLVASAFL
PFLPMLPLHLLIQNLLYDVSQVAIPFDNVDDEQIQKPQRWNPADLGRFMIFFGPISSIFD
ILTFCLMWWVFHANTPETQTLFQSGWFVVGLLSQTLIVHMIRTRRVPFIQSCASWPLMIM
TVIVMIVGIALPFSPLASYLQLQALPLSYFPWLVAILAGYMTLTQLVKGFYSRRYGWQ