Protein Info for OKFHMN_11470 in Escherichia coli ECRC101

Name: yjiN
Annotation: Uncharacterized protein YjiN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 395 to 417 (23 residues), see Phobius details PF04286: DUF445" amino acids 44 to 414 (371 residues), 392.4 bits, see alignment E=2e-121

Best Hits

Swiss-Prot: 98% identical to YJIN_ECOLI: Uncharacterized protein YjiN (yjiN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_5850)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>OKFHMN_11470 Uncharacterized protein YjiN (Escherichia coli ECRC101)
MNKLIELRRAKMLALSLLLIAAATFVVTLFLPPNFWVSGVKAIAEAAMVGALADWFAVVA
LFRRVPIPIISRHTAIIPRNKDRIGENLGQFVQKKFLDTQSLVALIRRHEPALLIGNWFS
QPENARRVGQHLLQIMSGFLELTDDARIQRLLKRAVHRAIDKVDLSGTSALMLESMTKND
RHQVLLDTLIAQLIALLQRDKSRKFIAQQIVRWLESEHPLKAKILPTEWLGEHSAELVSD
AVNSLLDDISRDRAHQIRHAFDRATFALIDKLKNDPEMTARADAVKSYLKEDEAFLSELW
GDLREWLKADINSEDSRVKERIARAGQWFGETLIADDALRASLNGHLEQAAHRVAPEFSA
FLTRHISDTVKSWDARDMSRQIELNIGKDLQFIRVNGTLVGGCIGLILYLLSQLPALFPL
GNF