Protein Info for OKFHMN_10340 in Escherichia coli ECRC101

Name: sfsA
Annotation: DNA/RNA nuclease SfsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 TIGR00230: sugar fermentation stimulation protein" amino acids 1 to 234 (234 residues), 352.7 bits, see alignment E=4.1e-110 PF17746: SfsA_N" amino acids 13 to 80 (68 residues), 78 bits, see alignment E=4.6e-26 PF03749: SfsA" amino acids 85 to 222 (138 residues), 172 bits, see alignment E=6e-55

Best Hits

Swiss-Prot: 100% identical to SFSA_ECO5E: Sugar fermentation stimulation protein A (sfsA) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K06206, sugar fermentation stimulation protein A (inferred from 100% identity to eco:b0146)

Predicted SEED Role

"Sugar/maltose fermentation stimulation protein homolog" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>OKFHMN_10340 DNA/RNA nuclease SfsA (Escherichia coli ECRC101)
MEFSPPLQRATLIQRYKRFLADVITPDGRELTLHCPNTGAMTGCATPGDTVWYSTSDNTK
RKYPHTWELTQSQSGAFICVNTLWANRLTKEAILNESISELSGYSSLKSEVKYGAERSRI
DFMLQADSRPDCYIEVKSVTLAENEQGYFPDAVTERGQKHLRELMSVAAEGQRAVIFFAV
LHSAITRFSPARHIDEKYAQLLSEAQQRGVEILAYKAEISAEGMALKKSLPVTL