Protein Info for OKFHMN_09900 in Escherichia coli ECRC101

Name: tssH
Annotation: type VI secretion system ATPase TssH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 927 TIGR03345: type VI secretion ATPase, ClpV1 family" amino acids 16 to 901 (886 residues), 1118.3 bits, see alignment E=0 PF00004: AAA" amino acids 223 to 334 (112 residues), 30 bits, see alignment E=2.3e-10 amino acids 656 to 773 (118 residues), 27.3 bits, see alignment E=1.6e-09 PF17871: AAA_lid_9" amino acids 363 to 453 (91 residues), 96.5 bits, see alignment E=3e-31 PF07724: AAA_2" amino acids 650 to 811 (162 residues), 175.2 bits, see alignment E=4.2e-55 PF07728: AAA_5" amino acids 655 to 776 (122 residues), 42.5 bits, see alignment E=2.3e-14 PF10431: ClpB_D2-small" amino acids 817 to 892 (76 residues), 36.1 bits, see alignment E=1.8e-12

Best Hits

KEGG orthology group: K11907, type VI secretion system protein VasG (inferred from 100% identity to eok:G2583_0230)

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (927 amino acids)

>OKFHMN_09900 type VI secretion system ATPase TssH (Escherichia coli ECRC101)
MIQIDLPTLVKRLNLFSRQALEMAASECMSQQAAEITVSHVLIQMLAMPRSDLRVITRQG
DIGMEELRQALTVENYTTARSADSYPAFSPMLVEWLKEGWLLASAEMQHSELRGGVLLLA
LLHSPLRYIPPAAARLLTGINRDRLQQDFVQWTQESAESVVPDADGKGAGTLTDASDTLL
ARYAKNMTEDARNGRLAPVLCRDHEIDLMIDILCRRRKNNPVVVGEAGVGKSALIEGLAL
RIVAGQVPDKLKNTDIMTLDLGALQAGASVKGEFEKRFKGLMAEVISSPVPVILFIDEAH
TLIGAGNQQGGLDISNLLKPALARGELKTIAATTWSEYKKYFEKDAALSRRFQLVKVSEP
NAAEATIILRGLSAVYERSHGVLIDDDALQAAATLSERYLSGRQLPDKAIDVLDTACARV
AINLSSPPKQISALTTLSHQQEAEIRQLERELRIGLRTDTSRMTEVLVQYDETLTALDEL
EAAWHQQQTLVREIIALRQQLLGVAEDDAAPLPDADTVEDTQPESESESESESEQDNTGA
VPADETDREQPEETAETVSPVQRLAQLTAELDALHNDRLLVSPHVDKKQIAAVIAEWTGV
PLNRLSQNEMSVITDLPKWLGDTIKGQDLAIASLHKHLLTARADLRRPGRPLGAFLLAGP
SGVGKTETVLQLAELLYGGRQYLTTINMSEFQEKHTVSRLIGSPPGYVGYGEGGVLTEAI
RQKPYSVVLLDEVEKAHPDVLNLFYQAFDKGEMADGEGRLIDCKNIVFFLTSNLGYQVIV
EHADDPETMQEALYPVLADFFKPALLARMEVVPYLPLSKETLATIIAGKLARLDNVLRSR
FGAEVVIEPEVTDEIMSRVTRAENGARMLESVIDGDMLPPLSLLLLQKMAANTAIARIRL
SAVDGAFTADVEDAQNDESVTKDETVL