Protein Info for OKFHMN_09760 in Escherichia coli ECRC101

Name: dinJ
Annotation: type II toxin-antitoxin system antitoxin DinJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 86 TIGR02384: addiction module antitoxin, RelB/DinJ family" amino acids 1 to 84 (84 residues), 83.5 bits, see alignment E=5e-28 PF04221: RelB" amino acids 4 to 84 (81 residues), 117.5 bits, see alignment E=9.4e-39

Best Hits

Swiss-Prot: 99% identical to DINJ_ECOBD: Antitoxin DinJ (dinJ) from Escherichia coli (strain B / BL21-DE3)

KEGG orthology group: K07473, DNA-damage-inducible protein J (inferred from 98% identity to eco:b0226)

MetaCyc: 98% identical to antitoxin/DNA-binding transcriptional repressor DinJ (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"DNA-damage-inducible protein J" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (86 amino acids)

>OKFHMN_09760 type II toxin-antitoxin system antitoxin DinJ (Escherichia coli ECRC101)
MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREKALPFDLREPNQLTIQ
SIKNSEAGVDVHKAKDADDLFDKLGV