Protein Info for OKFHMN_09140 in Escherichia coli ECRC100

Annotation: Bacterial Ig-like domain, group 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF09134: Invasin_D3" amino acids 25 to 124 (100 residues), 47.6 bits, see alignment E=2.8e-16 amino acids 129 to 226 (98 residues), 48.7 bits, see alignment E=1.3e-16 amino acids 231 to 327 (97 residues), 45.3 bits, see alignment E=1.5e-15 amino acids 342 to 431 (90 residues), 53.3 bits, see alignment E=4.7e-18 PF02369: Big_1" amino acids 351 to 416 (66 residues), 62.7 bits, see alignment E=4e-21 amino acids 450 to 482 (33 residues), 34.8 bits, see alignment (E = 2e-12)

Best Hits

Predicted SEED Role

"Putative adhesin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (491 amino acids)

>OKFHMN_09140 Bacterial Ig-like domain, group 1 (Escherichia coli ECRC100)
VRAFSEQYQLGTLQQTLKFVAGPLDAAHSSITLNPDKPVVGGTVTAIWTVKDAYDNPVTS
LTPEAPSLAGAAAEGSTASGWTNNGDGTWTAQITLGSTAGELEVMPKLNGQNAAANAAKV
TVVADALSSNQSKVSVAEDHVKAGESTTVTLVAKDAHGNAISGLALSASLTGTASEGATV
SSWTEKGNGSYVATLTTGGKTGELRVMPLFNGQPAATEAAQLTVIAGEMSSANSTLVADN
KAPTVKTTTELTFTVKDAYGNPVTGLKPDAPVFSGAASTGSERPSAGNWTEKGNGVYVST
LTLGSAAGQLSVMPRVNGQNAVAQPLVLNVAGDASKAEIRDMTVKVNNQLANGQSANQIT
LTVVDTYGNPLQGQEVTLTLPQGVTSKTGNTVTTNAAGKADIELMSTVAGEHNISASVNG
AQKTVTVKFNADASTGQANLQVDAAAQKVANGKDAFTLTANVEDKNGNPVPGSLVTFNLP
RGVKPLTGDNV