Protein Info for OKFHMN_08760 in Escherichia coli ECRC101

Name: dmpG
Annotation: 4-hydroxy-2-oxovalerate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03217: 4-hydroxy-2-oxovalerate aldolase
  • amino acids 4 to 336 (333 residues), 600.5 bits, E=4.4e-185
• PF00682: HMGL-like
  • amino acids 6 to 262 (257 residues), 230.9 bits, E=2.1e-72
• PF07836: DmpG_comm
  • amino acids 274 to 334 (61 residues), 104.6 bits, E=1.6e-34

Best Hits

Swiss-Prot: 100% identical to HOA_ECO57: 4-hydroxy-2-oxovalerate aldolase (mhpE) from Escherichia coli O157:H7

KEGG orthology group: K01666, 4-hydroxy 2-oxovalerate aldolase [EC: 4.1.3.39] (inferred from 99% identity to eco:b0352)

MetaCyc: 99% identical to 4-hydroxy-2-oxovalerate aldolase (Escherichia coli K-12 substr. MG1655)
4-hydroxy-2-oxovalerate aldolase. [EC: 4.1.3.39]

Predicted SEED Role

"4-hydroxy-2-oxovalerate aldolase (EC 4.1.3.39)" (EC 4.1.3.39)

MetaCyc Pathways

• 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (8/8 steps found)
• 2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
• catechol degradation I (meta-cleavage pathway) (3/5 steps found)
• catechol degradation II (meta-cleavage pathway) (3/7 steps found)
• toluene degradation I (aerobic) (via o-cresol) (3/7 steps found)
• toluene degradation V (aerobic) (via toluene-cis-diol) (3/7 steps found)
• p-cumate degradation (3/8 steps found)
• meta cleavage pathway of aromatic compounds (3/10 steps found)
• naphthalene degradation to acetyl-CoA (4/12 steps found)
• p-cymene degradation (3/11 steps found)
• L-tryptophan degradation IX (3/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (3/12 steps found)
• toluene degradation IV (aerobic) (via catechol) (3/13 steps found)
• mandelate degradation to acetyl-CoA (3/18 steps found)
• superpathway of aerobic toluene degradation (3/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (4/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (6/42 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Carbazole degradation
• Ethylbenzene degradation
• Fluorene degradation
• Phenylalanine metabolism
• Styrene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.39

Protein Sequence (337 amino acids)

>OKFHMN_08760 4-hydroxy-2-oxovalerate aldolase (Escherichia coli ECRC101)
MNGKKLYISDVTLRDGMHAIRHQYSLENVRQIAKALDDARVDSIEVAHGDGLQGSSFNYG
FGAHSDLEWIEAAADVVKHAKIATLLLPGIGTIHDLKNAWQAGARVVRVATHCTEADVSA
QHIQYARELGMDTVGFLMMSHMTTPENLAKQAKLMEGYGATCIYVVDSGGAMNMSDIRDR
FRALKAVLKPETQTGMHAHHNLSLGVANSIAAVEEGCDRIDASLAGMGAGAGNAPLEVFI
AAVDKLGWQHGADLYALMDAADDLVRPLQDRPVRVDRETLALGYAGVYSSFLRHCETAAA
RYGLSAVDILVELGKRRMVGGQEDMIVDVALDLRNNK