Protein Info for OKFHMN_08005 in Escherichia coli ECRC100

Name: ybbJ
Annotation: Inner membrane protein YbbJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details PF01957: NfeD" amino acids 94 to 148 (55 residues), 48.7 bits, see alignment E=3.4e-17

Best Hits

Swiss-Prot: 98% identical to YBBJ_SHIFL: Inner membrane protein YbbJ (ybbJ) from Shigella flexneri

KEGG orthology group: K07340, hypothetical protein (inferred from 98% identity to eco:b0488)

Predicted SEED Role

"Putative activity regulator of membrane protease YbbK" in subsystem YbbK

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>OKFHMN_08005 Inner membrane protein YbbJ (Escherichia coli ECRC100)
MMELIVVHPHIFWLSLGGLLLAAEMLGGNGYLLWSGVAAVITGLVVWLVPLGWEWQGVMF
AVLTLLAAWLWWKWLSRRVREQKHSDSHLNQRGQQLIGRRFVLESPLVNGRGHMRVGDSS
WPVSASEDLGAGTHVEVIAIEGITLIIRAVIA