Protein Info for OKFHMN_07735 in Escherichia coli ECRC100

Name: rhsA
Annotation: type IV secretion protein Rhs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 TIGR01643: YD repeat (two copies)" amino acids 51 to 69 (19 residues), 17.4 bits, see alignment (E = 4.8e-07) amino acids 83 to 114 (32 residues), 22.2 bits, see alignment (E = 1.5e-08) PF05593: RHS_repeat" amino acids 83 to 112 (30 residues), 24.8 bits, see alignment (E = 2.3e-09) TIGR03696: RHS repeat-associated core domain" amino acids 232 to 294 (63 residues), 69.3 bits, see alignment E=3.1e-23 PF15640: Tox-MPTase4" amino acids 310 to 436 (127 residues), 110.8 bits, see alignment E=4.9e-36

Best Hits

KEGG orthology group: None (inferred from 99% identity to eok:G2583_0726)

Predicted SEED Role

"Rhs-family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>OKFHMN_07735 type IV secretion protein Rhs (Escherichia coli ECRC100)
VTASGTGLGYGEGDESYGYDSCGYLKAQSAGGHRISEETDQYAGGHRLKQAGNTQYDYDA
AGRMVSRTRHRDGYRPETERFRWDSRDQLTGYCSAQGEQWEYRHDASGRRTEKRCDRKKI
RFTYLWDGDSIAEIREYRDDELYSVRHLVFNGFELISQQCSRVRQPHPSVAPQWVTRTNH
AVNDLTGRPLMLFNSEGKTVWRPGQTSLWGLALSLPADTDYPDPRGERDPEADPGLLYAG
QWQDAESGLCYNRFRYYEPETGMYLVSDPLGLQGGEQTYRYVPNPCGWVDPLGLAASSKI
SSLMDYIGDGRRVSGHTGFLDGVRLSRSQINNIAKEMEKLGIKVIRKADKYLPPNARAAF
DYGLRNIYLRKNATLYEVYHEVIHAKQFAKIGREAYEALGRLSREEHVLNEILKSKNLFN
EAEIAHAIKYVEGLREKFMMGLIN