Protein Info for OKFHMN_07515 in Escherichia coli ECRC101

Name: dsbG
Annotation: thiol:disulfide interchange protein DsbG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF13462: Thioredoxin_4" amino acids 110 to 170 (61 residues), 29.4 bits, see alignment E=8.7e-11 PF13098: Thioredoxin_2" amino acids 115 to 241 (127 residues), 50.5 bits, see alignment E=2.4e-17

Best Hits

Swiss-Prot: 100% identical to DSBG_ECO57: Thiol:disulfide interchange protein DsbG (dsbG) from Escherichia coli O157:H7

KEGG orthology group: K03805, thiol:disulfide interchange protein DsbG (inferred from 100% identity to eco:b0604)

MetaCyc: 100% identical to protein sulfenic acid reductase and chaperone DsbG (Escherichia coli K-12 substr. MG1655)
Protein disulfide-isomerase. [EC: 5.3.4.1]; RXN-20019 [EC: 5.3.4.1]

Predicted SEED Role

"Thiol:disulfide interchange protein DsbG precursor" in subsystem Periplasmic disulfide interchange

Isozymes

Compare fitness of predicted isozymes for: 5.3.4.1

Use Curated BLAST to search for 5.3.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>OKFHMN_07515 thiol:disulfide interchange protein DsbG (Escherichia coli ECRC101)
MLKKILLLALLPAIAFAEELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYL
TPDGKHAISGYMYNEKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYV
FADPFCPYCKQFWQQARPWVDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQEYE
ASGGKLKLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKT
LNIIMGNK