Protein Info for OKFHMN_07445 in Escherichia coli ECRC100

Name: citC
Annotation: [citrate (pro-3S)-lyase] ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 TIGR00124: [citrate (pro-3S)-lyase] ligase" amino acids 7 to 342 (336 residues), 583.4 bits, see alignment E=1.2e-179 TIGR00125: cytidyltransferase-like domain" amino acids 147 to 204 (58 residues), 39 bits, see alignment E=6.9e-14 PF08218: Citrate_ly_lig" amino acids 147 to 333 (187 residues), 279.1 bits, see alignment E=7.7e-88

Best Hits

Swiss-Prot: 99% identical to CITC_ECOLI: [Citrate [pro-3S]-lyase] ligase (citC) from Escherichia coli (strain K12)

KEGG orthology group: K01910, [citrate (pro-3S)-lyase] ligase [EC: 6.2.1.22] (inferred from 99% identity to eco:b0618)

MetaCyc: 50% identical to [citrate [pro-3S]-lyase] ligase (Klebsiella pneumoniae)
[Citrate (pro-3S)-lyase] ligase. [EC: 6.2.1.22]

Predicted SEED Role

"[Citrate [pro-3S]-lyase] ligase (EC 6.2.1.22)" (EC 6.2.1.22)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.2.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (352 amino acids)

>OKFHMN_07445 [citrate (pro-3S)-lyase] ligase (Escherichia coli ECRC100)
MFGNDIFTRVKRSENKKMAEIAQFLHENDLSVDTTVEVFITVTRDEKLIACGGIAGNIIK
CVAISESVRGEGLALTLATELINLAYERHSTHLFIYTKTEYEALFRQCGFSTLTSVPGVM
VLMENSATRLKRYAESLKKFRHPGNKIGCIAMNANPFTNGHRYLIQQAAAQCDWLHLFLV
KEDSSRFPYEDRLDLVLKGTADIPRLTVHRGSEYIISRATFPCYFIKEQSVINHCYTEID
LKIFRQYLAPALGVTHRFVGTESFCRVTAQYNQDMRYWLETPTISAAPIELVEIERLRYQ
EMPISASRVRQLLAKNDLTAIAPLVPAVTLHYLQNLLEHSRQDAAARQKTPA