Protein Info for OKFHMN_07415 in Escherichia coli ECRC100

Name: crcB
Annotation: fluoride efflux transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 67 to 91 (25 residues), see Phobius details amino acids 97 to 121 (25 residues), see Phobius details PF02537: CRCB" amino acids 6 to 117 (112 residues), 98.8 bits, see alignment E=1e-32 TIGR00494: protein CrcB" amino acids 6 to 121 (116 residues), 150.2 bits, see alignment E=1.5e-48

Best Hits

Swiss-Prot: 99% identical to CRCB_ECO5E: Putative fluoride ion transporter CrcB (crcB) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K06199, CrcB protein (inferred from 98% identity to ecl:EcolC_3020)

MetaCyc: 98% identical to F- channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-498

Predicted SEED Role

"CrcB protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>OKFHMN_07415 fluoride efflux transporter CrcB (Escherichia coli ECRC100)
VLQLLLAVFIGGGTGSVARWLLSMRFNPLHQAIPLGTLAANLIGAFIIGMGFAWFSRMTN
IDPVWKVLITTGFCGGLTTFSTFSAEVVFLLQEGRFGWALLNVFVNLLGSFAMTALAFWL
FSASTAH