Protein Info for OKFHMN_07385 in Escherichia coli ECRC101

Name: ybeD
Annotation: DUF493 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 87 PF04359: DUF493" amino acids 7 to 87 (81 residues), 99.6 bits, see alignment E=6.1e-33

Best Hits

Swiss-Prot: 100% identical to YBED_ECOSM: UPF0250 protein YbeD (ybeD) from Escherichia coli (strain SMS-3-5 / SECEC)

KEGG orthology group: K09158, hypothetical protein (inferred from 100% identity to eco:b0631)

Predicted SEED Role

"Proposed lipoate regulatory protein YbeD" in subsystem Lipoic acid metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (87 amino acids)

>OKFHMN_07385 DUF493 domain-containing protein (Escherichia coli ECRC101)
MKTKLNELLEFPTPFTYKVMGQALPELVDQVVEVVQRHAPGDYTPTVKPSSKGNYHSVSI
TINATHIEQVETLYEELGKIDIVRMVL