Protein Info for OKFHMN_07000 in Escherichia coli ECRC101

Name: pxpC
Annotation: 5-oxoprolinase subunit PxpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00724: biotin-dependent carboxylase uncharacterized domain
  • amino acids 1 to 310 (310 residues), 481.9 bits, E=3.8e-149
• PF02626: CT_A_B
  • amino acids 25 to 281 (257 residues), 320.3 bits, E=5.9e-100

Best Hits

Swiss-Prot: 99% identical to PXPC_ECOLI: 5-oxoprolinase subunit C (pxpC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b0712)

MetaCyc: 99% identical to 5-oxoprolinase component C (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Allophanate hydrolase 2 subunit 2 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

• uracil degradation III (5/5 steps found)
• L-citrulline degradation (3/3 steps found)
• cyanate degradation (3/3 steps found)
• γ-glutamyl cycle (5/6 steps found)
• 5-oxo-L-proline metabolism (5/6 steps found)
• allantoin degradation IV (anaerobic) (7/9 steps found)
• L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
• urea degradation I (2/3 steps found)
• superpathway of allantoin degradation in yeast (4/6 steps found)
• cyanuric acid degradation II (3/5 steps found)
• cyanuric acid degradation I (2/5 steps found)
• superpathway of atrazine degradation (3/8 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Atrazine degradation
• Glutathione metabolism
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54 or 3.5.2.9

Protein Sequence (310 amino acids)

>OKFHMN_07000 5-oxoprolinase subunit PxpC (Escherichia coli ECRC101)
MLKIIRAGMYTTVQDGGRHGFRQSGISHCGALDMPALRIANLLVGNDANAPALEITLGQL
TVEFETDGWFALTGAGCEARLDDNAVWTGWRLPMKAGQRLTLKRPQHGMRSYLAVAGGID
VPPVMGSCSTDLKVGIGGLEGRLLKDGDRLPIGKAKRDFMEAQGVKQLLWGNRIRALPGP
EYHEFDRASQDAFWRSPWQLSSQSNRMGYRLQGQILKRTTDRELLSHGLLPGVVQVPHNG
QPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFVQCSLEEALKARQDQQRYFE
QLAWRLHNEN