Protein Info for OKFHMN_06565 in Escherichia coli ECRC100

Annotation: holin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 71 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 36 to 58 (23 residues), see Phobius details PF04971: Phage_holin_2_1" amino acids 5 to 67 (63 residues), 112.1 bits, see alignment E=4.9e-37

Best Hits

Swiss-Prot: 83% identical to ESSD_ECOLI: Prophage lysis protein S homolog EssD (essD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to ecs:ECs2969)

Predicted SEED Role

"Phage holin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (71 amino acids)

>OKFHMN_06565 holin (Escherichia coli ECRC100)
MYQMEKITTGVSYTTSAVGTGYWLLQLLDKVSPSQWVAIGVLGSLVFGLLTYLTNLYFKI
KEDKRKAARGE