Protein Info for OKFHMN_06170 in Escherichia coli ECRC100

Name: ybiR
Annotation: Inner membrane protein YbiR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 42 to 64 (23 residues), see Phobius details amino acids 81 to 108 (28 residues), see Phobius details amino acids 156 to 182 (27 residues), see Phobius details amino acids 201 to 217 (17 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 248 to 268 (21 residues), see Phobius details amino acids 286 to 302 (17 residues), see Phobius details amino acids 312 to 335 (24 residues), see Phobius details amino acids 347 to 369 (23 residues), see Phobius details PF03600: CitMHS" amino acids 27 to 304 (278 residues), 148.5 bits, see alignment E=2.7e-47 PF00939: Na_sulph_symp" amino acids 41 to 170 (130 residues), 31.2 bits, see alignment E=1.3e-11

Best Hits

Swiss-Prot: 98% identical to YBIR_ECOLI: Inner membrane protein YbiR (ybiR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b0818)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>OKFHMN_06170 Inner membrane protein YbiR (Escherichia coli ECRC100)
MSLLFLRTLQGDRFFQLLILVGIGLSFFVPFAPKSWPAAIDWHTIITLSGLMLLTKGVEL
SGYFDVLGRKMVRRFATERRLAMFMVLAAALLSTFLTNDVTLFIVVPLTITLKRLCEIPV
NRLIIFEALAVNAGSLLTPIGNPQNILIWGRSGLSFAGFIAQMAPLAGAMMLTLLLLCWC
CFPGKALQYHTGVQTPEWKPRLVWSCLGLYIVFLTALEFKQELWGLVIVAAGFALLARRV
VLSVDWTLLLVFMAMFIDVHLLTQLPALQGVLGNVSHLSEPGLWLTAIGLSQVISNVPST
ILLLNYVPPSLLLAWAVNVGGFGLLPGSLANLIALRMANDRRIWWRFHLYSIPMLLWAAL
VGYVLLVMIPAW