Protein Info for OKFHMN_05935 in Escherichia coli ECRC101

Name: rlmC
Annotation: 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02085: 23S rRNA (uracil-5-)-methyltransferase RumB
  • amino acids 2 to 374 (373 residues), 731.6 bits, E=9.2e-225
• PF05958: tRNA_U5-meth_tr
  • amino acids 208 to 374 (167 residues), 60 bits, E=3.3e-20
• PF05175: MTS
  • amino acids 235 to 310 (76 residues), 25 bits, E=2e-09
• PF13847: Methyltransf_31
  • amino acids 236 to 294 (59 residues), 28.5 bits, E=1.9e-10

Best Hits

Swiss-Prot: 100% identical to RLMC_ECO57: 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC (rlmC) from Escherichia coli O157:H7

KEGG orthology group: K03212, RNA methyltransferase, TrmA family [EC: 2.1.1.-] (inferred from 100% identity to etw:ECSP_0959)

MetaCyc: 98% identical to 23S rRNA m5U747 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11600 [EC: 2.1.1.189]

Predicted SEED Role

"23S rRNA (Uracil-5-) -methyltransferase rumB (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.189

Protein Sequence (375 amino acids)

>OKFHMN_05935 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC (Escherichia coli ECRC101)
MQCALYDAGRCRSCQWITQPIPEQLSAKTADLKNLLADFPVEEWCAPVSGPEQGFRNKAK
MVVSGSVEKPLLGMLHRDGTPEDLCDCPLYPASFAPVFAALKPFIARAGLTPYNVARKRG
ELKYILLTESQSDGGMMLRFVLRSETKLAQLRKALPWLQAQLPQLKVITVNIQPVHMAIM
EGETEIYLTEQQALVERFNDVPLWIRPQSFFQTNPAVASQLYATARDWVRQLPVKHMWDL
FCGVGGFGLHCATPDMQLTGIEIALEAIACAKQSAAELGLTRLQFQALDSTQFATAQGEV
PELVLVNPPRRGIGKPLCDYLSTMAPRFIIYSSCNAQTMAKDIRELPGYRIERVQLFDMF
PHTAHYEVLTLLVKM