Protein Info for OKFHMN_05380 in Escherichia coli ECRC101

Name: ompF
Annotation: porin OmpF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF13609: Porin_4" amino acids 11 to 335 (325 residues), 73.9 bits, see alignment E=2e-24 PF00267: Porin_1" amino acids 28 to 362 (335 residues), 459.1 bits, see alignment E=1.1e-141

Best Hits

Swiss-Prot: 99% identical to OMPF_ECOLI: Outer membrane porin F (ompF) from Escherichia coli (strain K12)

KEGG orthology group: K09476, outer membrane pore protein F (inferred from 99% identity to eco:b0929)

MetaCyc: 99% identical to outer membrane porin F (Escherichia coli K-12 substr. MG1655)
RXN0-2481; RXN0-7199; RXN0-7200; RXN0-7201; RXN0-7202; RXN0-7203; RXN0-7204; RXN0-7206; RXN0-7207; RXN0-7208; RXN0-7209; RXN0-7210; RXN0-7211; RXN0-7241; RXN0-7242; RXN0-7243; RXN0-7244; RXN0-7245; RXN0-7246; RXN0-7247; TRANS-RXN-380; TRANS-RXN0-490; TRANS-RXN0-598; TRANS-RXN0-601; TRANS-RXN0-603; TRANS-RXN0-604; TRANS-RXN0-606; TRANS-RXN0-607; TRANS-RXN0-608; TRANS-RXN0-609; TRANS-RXN0-611; TRANS-RXN0-612; TRANS-RXN0-614; TRANS-RXN0-615

Predicted SEED Role

"Outer membrane protein F precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>OKFHMN_05380 porin OmpF (Escherichia coli ECRC101)
MMKRNILAVIVPALLVAGTANAAEIYNKDGNKVDLYGKAVGLHYFSKGNGENSYGGNGDM
TYARLGFKGETQINSDLTGYGQWEYNFQGNNSEGADAQTGNKTRLAFAGLKYADVGSFDY
GRNYGVVYDALGYTDMLPEFGGDTAYSDDFFVGRVGGVATYRNSNFFGLVDGLNFAVQYL
GKNERDTARRSNGDGVGGSISYEYEGFGIVGAYGAADRTNLQEAQLLGNGKKAEQWATGL
KYDANNIYLAANYGETRNATPITNKFTNISGFANKTQDVLLVAQYQFDFGLRPSIAYTKS
KAKDVEGIGDVDLVNYFEVGATYYFNKNMSTYVDYIINQIDSDNKLGVGSDDTVAVGIVY
QF