Protein Info for OKFHMN_04655 in Escherichia coli ECRC100

Name: wrbA
Annotation: NAD(P)H:quinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR01755: NAD(P)H:quinone oxidoreductase, type IV" amino acids 2 to 196 (195 residues), 344.8 bits, see alignment E=8.9e-108 PF03358: FMN_red" amino acids 3 to 145 (143 residues), 57.1 bits, see alignment E=2.5e-19 PF00258: Flavodoxin_1" amino acids 6 to 123 (118 residues), 38.8 bits, see alignment E=1.6e-13

Best Hits

Swiss-Prot: 100% identical to NQOR_ECO5E: NAD(P)H dehydrogenase (quinone) (ECH74115_1242) from Escherichia coli O157:H7 (strain EC4115 / EHEC)

KEGG orthology group: K03809, Trp repressor binding protein (inferred from 99% identity to eco:b1004)

MetaCyc: 99% identical to NAD(P)H:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
NAD(P)H dehydrogenase (quinone). [EC: 1.6.5.2]

Predicted SEED Role

"Flavoprotein WrbA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>OKFHMN_04655 NAD(P)H:quinone oxidoreductase (Escherichia coli ECRC100)
MAKVLVLYYSMYGHIETMARAVAEGASKVDGAEVVVKRVPETMSPQLFEKAGGKTQTAPV
ATPQELANYDAIIFGTPTRFGNMSGQMRTFLDQTGGLWASGALYGKLASVFSSTGTGGGQ
EQTITSTWTTLAHHGMVIVPIGYAAQELFDVSQVRGGTPYGATTIAGGDGSRQPSQEELS
IARYQGEYVAGLAVKLNG