Protein Info for OKFHMN_04535 in Escherichia coli ECRC100

Name: dgcT
Annotation: putative diguanylate cyclase DgcT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 113 to 132 (20 residues), see Phobius details amino acids 151 to 169 (19 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details PF17158: MASE4" amino acids 43 to 274 (232 residues), 241.4 bits, see alignment E=9.2e-76 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 280 to 443 (164 residues), 155.6 bits, see alignment E=4.9e-50 PF00990: GGDEF" amino acids 282 to 439 (158 residues), 170.7 bits, see alignment E=2.3e-54

Best Hits

Swiss-Prot: 99% identical to DGCT_ECOLI: Probable diguanylate cyclase DgcT (dgcT) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecf:ECH74115_1267)

MetaCyc: 99% identical to probable diguanylate cyclase DgcT (Escherichia coli K-12 substr. MG1655)
Diguanylate kinase. [EC: 2.7.7.65]

Predicted SEED Role

"Sensory box/GGDEF domain protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.65

Use Curated BLAST to search for 2.7.7.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (452 amino acids)

>OKFHMN_04535 putative diguanylate cyclase DgcT (Escherichia coli ECRC100)
MEKDYLRISSTVLVSLLFGLALVLVNSWFNQPGVEEVVPRSTYLMVMIALFFIDTVAFIF
MQLYFIYDRRQFSNCILSLAFLSCLIYFVKTVIIIQQIIEGRLTSSVVQNDIAIYYLFRQ
MSLCILIFLALVNKVSENTKQRNLFSKKMTLCISLFFVFGGAIVAHILSSHYESYNLHIA
ELTNENGQVVWKASYVTIMIFMWLTLLSVNLYFNGLRYDIWNGVTVIAFCAVLYNISLLF
MSRYSVSTWYISRTIEVVSKLTVMVIFMCHIFSALRVTKNIAHRDPLTNIFNRNYFFNEL
TVQSASAKKTPYCVMIMDIDHFKKVNDTWGHPVGDQVIKTVVNIIGKSIRPDDLLARVGG
EEFGVLLTDIDTERAKALAERIRENVERLTGDNPEYAIPQKVTISIGAVVTQGNALNPNE
IYRLADNALYEAKETGRNKVVVRDVVNFCESP