Protein Info for OKFHMN_04515 in Escherichia coli ECRC101

Name: fabG
Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF00106: adh_short" amino acids 18 to 205 (188 residues), 169.2 bits, see alignment E=1.5e-53 PF01370: Epimerase" amino acids 21 to 123 (103 residues), 26.1 bits, see alignment E=1.1e-09 PF08659: KR" amino acids 21 to 177 (157 residues), 47 bits, see alignment E=5.8e-16 PF13561: adh_short_C2" amino acids 24 to 258 (235 residues), 176.3 bits, see alignment E=1.6e-55

Best Hits

Swiss-Prot: 55% identical to YGCW_ECOLI: Uncharacterized oxidoreductase YgcW (ygcW) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to ecs:ECs1275)

Predicted SEED Role

"FIG00553873: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>OKFHMN_04515 oxidoreductase (Escherichia coli ECRC101)
MSFSIEDFSLDFFSLHNKVAIVTGAAGELGRGLCSALAKAGANLLLVDIKEPDNRYLKHL
THEGVEVEFMTIDITKPDASCTIINRCLERFGQLDILVNNAGVCNINRPIDFNRNDWDPM
INLNLNAAFDMSQAALNIFVPQRKGKIINMCSVLSFHGGRWSPGYAATKHALAGLTKAYA
DDFAEYNIQINGIAPGYYVSEMTAIIYNNPKIKELIKGRIPAQRWGRAQDLMGAMVFLAS
AASDYVNGQLLVIDGGYSIR