Protein Info for OKFHMN_03920 in Escherichia coli ECRC100

Name: yeeS
Annotation: UPF0758 protein YeeS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 TIGR00608: DNA repair protein RadC" amino acids 36 to 158 (123 residues), 148.8 bits, see alignment E=9.9e-48 PF04002: RadC" amino acids 38 to 157 (120 residues), 152 bits, see alignment E=3.6e-49

Best Hits

Swiss-Prot: 99% identical to YEES_ECOLI: UPF0758 protein YeeS (yeeS) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to ece:Z1657)

Predicted SEED Role

"DNA repair protein RadC" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (158 amino acids)

>OKFHMN_03920 UPF0758 protein YeeS (Escherichia coli ECRC100)
MQQLSFLPGEMTPGERSLILRALQTLDRHLHEPGVAFTSTRAAREWLILNMAGLEREEFR
VLYLNNQNQLIAGETLFTGTINRTEVHPREVIKRALYHNAAAVVLAHNHPSGEVTPSKAD
RLITERLVQALGLVDIRVPDHLIVGGNQVFSFAEHGLL