Protein Info for OKFHMN_03855 in Escherichia coli ECRC101

Name: cgsF
Annotation: curli production assembly/transport protein CsgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF10614: CsgF" amino acids 6 to 129 (124 residues), 141.6 bits, see alignment E=8.9e-46

Best Hits

Swiss-Prot: 100% identical to CSGF_ECOL6: Curli production assembly/transport component CsgF (csgF) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K04338, curli production assembly/transport component CsgF (inferred from 100% identity to eco:b1038)

Predicted SEED Role

"Curli production assembly/transport component CsgF" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (138 amino acids)

>OKFHMN_03855 curli production assembly/transport protein CsgF (Escherichia coli ECRC101)
MRVKHAVVLLMLISPLSWAGTMTFQFRNPNFGGNPNNGAFLLNSAQAQNSYKDPSYNDDF
GIETPSALDNFTQAIQSQILGGLLSNINTGKPGRMVTNDYIVDIANRDGQLQLNVTDRKT
GQTSTIQVSGLQNNSTDF