Protein Info for OKFHMN_03830 in Escherichia coli ECRC100

Name: csgA
Annotation: curlin major subunit CsgA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF07012: Curlin_rpt" amino acids 41 to 75 (35 residues), 37.2 bits, see alignment 1.1e-13 amino acids 87 to 120 (34 residues), 40.7 bits, see alignment 9.4e-15 amino acids 115 to 142 (28 residues), 26 bits, see alignment 3.5e-10

Best Hits

Swiss-Prot: 100% identical to CSGA_ECO57: Major curlin subunit (csgA) from Escherichia coli O157:H7

KEGG orthology group: K04334, major curlin subunit (inferred from 100% identity to ece:Z1676)

Predicted SEED Role

"Major curlin subunit precursor CsgA" in subsystem Curli production

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>OKFHMN_03830 curlin major subunit CsgA (Escherichia coli ECRC100)
MKLLKVAAIAAIVFSGSALAGVVPQYGGGGGNHGGGGNNSGPNSELNIYQYGGGNSALAL
QADARNSDLTITQHGGGNGADVGQGSDDSSIDLTQRGFGNSATLDQWNGKDSHMTVKQFG
GGNGAAVDQTASNSTVNVTQVGFGNNATAHQY