Protein Info for OKFHMN_03705 in Escherichia coli ECRC100

Name: yceH
Annotation: UPF0502 protein YceH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 PF04337: DUF480" amino acids 5 to 158 (154 residues), 207.2 bits, see alignment E=6.4e-66

Best Hits

Swiss-Prot: 100% identical to YCEH_ECO57: UPF0502 protein YceH (yceH) from Escherichia coli O157:H7

KEGG orthology group: K09915, hypothetical protein (inferred from 99% identity to eco:b1067)

Predicted SEED Role

"Protein of unknown function YceH" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>OKFHMN_03705 UPF0502 protein YceH (Escherichia coli ECRC100)
MKYQLTALEARVIGCLLEKQVTTPEQYPLSVNGVVTACNQKTNREPVMNLSESEVQEQLD
NLVKRHYLRTVSGFGNRVTKYEQRFCNSEFGDLKLSAAEVALITTLLLRGAQTPGELRSR
AARMYEFSDMAEVELTLEQLANREDGPFVVRLAREPGKRESRYMHLFSGEVEDQPAVTDM
SNAVDGDLQARVEALEIEVAELKQRLDSLLAHLGD