Protein Info for OKFHMN_03525 in Escherichia coli ECRC101

Name: hinT
Annotation: purine nucleoside phosphoramidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 5 to 106 (102 residues), 84.6 bits, E=7.2e-28
• PF01230: HIT
  • amino acids 12 to 109 (98 residues), 109 bits, E=1.6e-35

Best Hits

Swiss-Prot: 99% identical to HINT_ECOLI: Purine nucleoside phosphoramidase (hinT) from Escherichia coli (strain K12)

KEGG orthology group: K12150, HIT-like protein HinT (inferred from 99% identity to eco:b1103)

MetaCyc: 99% identical to purine nucleoside phosphoramidase (Escherichia coli K-12 substr. MG1655)
3.9.1.-

Predicted SEED Role

"YcfF/hinT protein: a purine nucleoside phosphoramidase"

Protein Sequence (119 amino acids)

>OKFHMN_03525 purine nucleoside phosphoramidase (Escherichia coli ECRC101)
VAEETIFSKIIRREIPSDIVYQDDLVTAFRDISPQAPTHILIIPNILIPTVNDVSAEHEQ
ALGRMITVAAKIAEQEGIAEDGYRLIMNTNRHGGQEVYHIHMHLLGGRPLGPMLAHKGL