Protein Info for OKFHMN_02500 in Escherichia coli ECRC100

Name: acrA
Annotation: efflux transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00529: CusB_dom_1" amino acids 31 to 349 (319 residues), 45.6 bits, see alignment E=1.1e-15 TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 32 to 363 (332 residues), 274.8 bits, see alignment E=4.2e-86 PF13533: Biotin_lipoyl_2" amino acids 58 to 105 (48 residues), 32.7 bits, see alignment 9.9e-12 PF16576: HlyD_D23" amino acids 58 to 281 (224 residues), 51.9 bits, see alignment E=1.3e-17 PF13437: HlyD_3" amino acids 167 to 278 (112 residues), 25.8 bits, see alignment E=3e-09

Best Hits

Swiss-Prot: 52% identical to ACRA_ECOLI: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli (strain K12)

KEGG orthology group: K03585, membrane fusion protein (inferred from 100% identity to eok:G2583_1633)

MetaCyc: 52% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (373 amino acids)

>OKFHMN_02500 efflux transporter periplasmic adaptor subunit (Escherichia coli ECRC100)
MKYIATSVVAMLLLSGCDNTQSNNSSPSETEVGVVTVKSQPVSVVSELTGRTSAALSAEV
RPQVGGIIQKRLFKEGDLVKAGQPLYQIDAASYQAAWNEARAALQQAQALVKADCQKAQR
YARLVKENGVSQQDADDAQSTCAQDKASVAAKKAALETARINLDWTTVTAPISGRIGISS
VTPGALVTASQDTALTTIRGLDTMYVDLTRSSVDLLRLRKQSLATNSDTMSVSLILEDGT
TYSEKGRLELTEVAVDESTGSVTLRAIFPNPQQQLLPGMFVRARVDEGVMEDAILAPQQG
VTRDAKGNATALVVNKDNKVEQRTLETGETYGDKWLVLNGLHSGDRLIVEGSAKVTSGQT
VKAVEVQANGGNA