Protein Info for OKFHMN_02485 in Escherichia coli ECRC100

Name: araJ
Annotation: Bcr/CflA family drug resistance efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 42 to 63 (22 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 102 to 120 (19 residues), see Phobius details amino acids 132 to 156 (25 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 243 to 262 (20 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 335 to 355 (21 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 7 to 378 (372 residues), 278.8 bits, see alignment E=4.8e-87 PF07690: MFS_1" amino acids 14 to 352 (339 residues), 171.7 bits, see alignment E=3.3e-54 PF00083: Sugar_tr" amino acids 14 to 185 (172 residues), 48.4 bits, see alignment E=1.1e-16 PF06779: MFS_4" amino acids 25 to 353 (329 residues), 36.4 bits, see alignment E=6.2e-13

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 100% identity to ecf:ECH74115_1930)

Predicted SEED Role

"Putative membrane transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (387 amino acids)

>OKFHMN_02485 Bcr/CflA family drug resistance efflux transporter (Escherichia coli ECRC100)
MARVSLSWALILGLLAGIGPMCTDLYLPALPEMSEQLAATTTITQLTLTASLIGLGVGQL
LFGPLSDKIGRKRPLILSLLLFIVSSILCATTNNIYWLVVWRFIQGIAGAGGSVLSRSIA
RDKYQGVTLTQFFALLMTVNGLAPVLSPVLGGYIVSTFDWRTLFWVMAEISTVLLLGCVL
FINETLPENKRGSSLLLTGRSVVQNRRFMRFCLIQSFMLAGLFAYIGSSSFVLQKEFGFS
PMQFSLVFGLNGIGLIIASWIFSRLARRINAMTLLRGGLIAAILCALLTVLCAWTQLPIP
ALVALFFTIAFCSGIGTVGGAEAMSAVGTQESGTASALMGMSMFVFGGIAAPLSGFGGET
LLKMSLAITVCYTLAFLVALTRIDNQK