Protein Info for OKFHMN_02360 in Escherichia coli ECRC101

Name: ycjP
Annotation: Inner membrane ABC transporter permease protein YcjP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 78 to 100 (23 residues), see Phobius details amino acids 112 to 138 (27 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 186 to 210 (25 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details amino acids 243 to 264 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 89 to 267 (179 residues), 62.8 bits, see alignment E=1.8e-21

Best Hits

Swiss-Prot: 99% identical to YCJP_ECOLI: Inner membrane ABC transporter permease protein YcjP (ycjP) from Escherichia coli (strain K12)

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 99% identity to ecj:JW1305)

Predicted SEED Role

"Inner membrane ABC transporter permease protein YcjP" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>OKFHMN_02360 Inner membrane ABC transporter permease protein YcjP (Escherichia coli ECRC101)
MATNKRTLSRIGFYRGLALFLIITLFPFFVMLMTSFKSAKEAISLHPTLLPQQWTLEHYV
DIFNPVIFPFVDYFRNSMVVSVVSSVVAVFLGILGAYALSRLRFKGRMTINASFYTVYMF
SGILLVVPLFKIITALGIYDTEMALIITMVTQTLPTAVFMLKSYFDTIPDEIEEAAMMDG
LNRLQIIFRITVPLAMSGLISVFVYCFMVAWNDYLFASIFLSSASNFTLPVGLNALFSTP
DYIWGRMMAASLVTALPVVIMYALSERFIKSGLTAGGVKG