Protein Info for OKFHMN_02230 in Escherichia coli ECRC100

Name: abgT
Annotation: p-aminobenzoyl-glutamate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details amino acids 192 to 217 (26 residues), see Phobius details PF03806: ABG_transport" amino acids 1 to 227 (227 residues), 320.9 bits, see alignment E=5.6e-100

Best Hits

KEGG orthology group: K12942, aminobenzoyl-glutamate transport protein (inferred from 100% identity to ece:Z2431)

Predicted SEED Role

"Aminobenzoyl-glutamate transport protein" in subsystem p-Aminobenzoyl-Glutamate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>OKFHMN_02230 p-aminobenzoyl-glutamate transporter (Escherichia coli ECRC100)
MVIPENGILRDPINHTVMPSPFIKGIVPLIILFFFVVSLAYGIATRTIRRQADLPHLMIE
PMKEMAGFIVMVFPLAQFVAMFNWSNMGKFIAVGLTDILESSGLSGIPAFVGLALLSSFL
CMFIASGSAIWSILAPIFVPMFMLLGFHPAFAQILFRIADSSVLPLAPVSPFVPLFLGFL
QRYKPDAKLGTYYSLVLPYPLIFLVVWLLMLLAWYLVGLPIGPGIYPRLS