Protein Info for OKFHMN_01705 in Escherichia coli ECRC100

Name: ydcF
Annotation: Protein YdcF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF02698: DUF218" amino acids 39 to 171 (133 residues), 55.2 bits, see alignment E=3.7e-19

Best Hits

Swiss-Prot: 99% identical to YDCF_ECOLI: Protein YdcF (ydcF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b1414)

Predicted SEED Role

"Protein ydcF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>OKFHMN_01705 Protein YdcF (Escherichia coli ECRC100)
MNITPFPTLSTATIDAINVIGQWLAQDDFSGEVPYQADCVILAGNAVMPTIDAACKIARD
QQIPLLISGGIGHSTTFLYSAIAQHPHYNTIRTTGRAEATILADIAHQFWHIPHEKIWIE
DQSTNCGENARFSIALLNQAVERVHTAIVVQDPTMQRRTMATFRRMTGDNPDVPRWLSYP
GFVPQLGNNADSVIFINQLQGLWPVERYLSLLTGELPRLRDDSDGYGPRGRDFIVHVDFP
AEVIHAWQTLKHDAVLIEAMESRSLR