Protein Info for OKFHMN_01660 in Escherichia coli ECRC100

Name: trg
Annotation: methyl-accepting chemotaxis protein Trg

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 17 to 44 (28 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details PF02203: TarH" amino acids 11 to 178 (168 residues), 127.7 bits, see alignment E=7.3e-41 PF00672: HAMP" amino acids 221 to 271 (51 residues), 43.6 bits, see alignment 4.6e-15 PF00015: MCPsignal" amino acids 335 to 492 (158 residues), 200.7 bits, see alignment E=2.6e-63

Best Hits

Swiss-Prot: 99% identical to MCP3_ECOLI: Methyl-accepting chemotaxis protein III (trg) from Escherichia coli (strain K12)

KEGG orthology group: K05876, methyl-accepting chemotaxis protein III, ribose and galactose sensor receptor (inferred from 100% identity to ece:Z2300)

Predicted SEED Role

"Methyl-accepting chemotaxis protein III (ribose and galactose chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (546 amino acids)

>OKFHMN_01660 methyl-accepting chemotaxis protein Trg (Escherichia coli ECRC100)
MNTTPSQRLGFLHHIRLVPLFACILGGILVLFALSSALAGYFLWQADRDQRDVTAEIEIR
TGLANSSDFLRSARINMIQAGAASRIAEMEAMKRNIAQAESEIKQSQQGYRAYQNRPVKT
PADEALDTELNQRFQAYITGMQPMLKYAKNGMFEAIINHESEQIRTLDNAYTDILNKAVK
IRSTRANQLAELAHQRTRLGGMFMIGAFVLALVMTLITFMVLRRIVIRPLQHAAQRIEKI
ASGDLTMKDEPAGRNEIGRLSRHLQQMQHSLGMTVGTVRQGAEEIYRGTSEISAGNADLS
SRTEEQAAAIEQTAASMEQLTATVKQNADNAHYASKLAQEASIKASDGGQTVSGVVKTMG
AISTSSKKISEITAVINSIAFQTNILALNAAVEAARAGEQGRGFAVVASEVRTLASRSAQ
AAKEIEGLISESVRLIDLGSDEVATAGKTMSTIVDAVASVTHIMQEIAAASDEQSRGITQ
VSQAISEMDKVTQQNASLVEEASAAAVSLEEQAARLTEAVDVFRLNKQSVLAEPRGAGEP
VSFAPV