Protein Info for OKFHMN_01320 in Escherichia coli ECRC100

Name: ddpA
Annotation: putative D,D-dipeptide-binding periplasmic protein DdpA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00496: SBP_bac_5
  • amino acids 78 to 433 (356 residues), 337.5 bits, E=5.4e-105

Best Hits

Swiss-Prot: 99% identical to DDPA_ECOLI: Probable D,D-dipeptide-binding periplasmic protein DdpA (ddpA) from Escherichia coli (strain K12)

KEGG orthology group: K02035, peptide/nickel transport system substrate-binding protein (inferred from 99% identity to eco:b1487)

Predicted SEED Role

"Dipeptide-binding ABC transporter, periplasmic substrate-binding component (TC 3.A.1.5.2); Putative hemin-binding lipoprotein" (TC 3.A.1.5.2)

Protein Sequence (516 amino acids)

>OKFHMN_01320 putative D,D-dipeptide-binding periplasmic protein DdpA (Escherichia coli ECRC100)
MKRSISFRPTLLALVLATTFPVAHAAVPKDMLVIGKAADPQTLDPAVTIDNNDWTVTYPS
YQRLVQYKTDGDKGSTDVEGDLASSWKASNDQKEWTFTLKDNAKFADGTPVTAEAVKLSF
ERLLKIGQGPAEAFPKDLKIDAPDEHTVKFTLSQPFAPFLYTLANDGASIINPAVLKEHA
ADDARGFLAQNTAGSGPFMLKSWQKGQQLVLVPNPHYPGNKPNFKRVSVKIIGESASRRL
QLSRGDIDIADALPVDQLNALKQENKVNVAEYPSLRVTYLYLNNSKAPLNQADLRRAISW
STDYQGMVNGILSGNGKQMRGPIPEGMWGYDATAMQYNHDETKAKAEWDKVTSKPTSLTF
LYSDNDPNWEPIALATQSSLNKLGINVKLEKLANATMRDRVGKGDYDIAIGNWSPDFADP
YMFMNYWFESDKKGLPGNRSFYENSEVDKLLRNALATTDQTQRTRDYQQAQKIVIDDAAY
VYLFQKNYQLAMNKEVKGFVFNPMLEQVFNINTMSK