Protein Info for OKFHMN_01255 in Escherichia coli ECRC101

Name: ydeO
Annotation: acid stress response transcriptional regulator YdeO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12833: HTH_18
  • amino acids 157 to 231 (75 residues), 58.3 bits, E=8e-20
• PF00165: HTH_AraC
  • amino acids 199 to 229 (31 residues), 31.2 bits, 1.8e-11

Best Hits

Swiss-Prot: 100% identical to YDEO_ECO57: HTH-type transcriptional regulator YdeO (Z2209) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to ecg:E2348C_1626)

Predicted SEED Role

"Putative formate dehydrogenase oxidoreductase protein" in subsystem Formate hydrogenase

MetaCyc Pathways

• formate oxidation to CO₂ (1/1 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• oxalate degradation VI (2/4 steps found)
• oxalate degradation III (2/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

Protein Sequence (253 amino acids)

>OKFHMN_01255 acid stress response transcriptional regulator YdeO (Escherichia coli ECRC101)
MSLVCSVIFIHHAFNANILDKDYAFSDGEILMVDNAVRTHFEPYERHFKEIGFNENTIKK
YLQCTNIQTVTMPVPAKFLRASNVPTGLLNEMIAYLNSEERNHHNFSELLLFSCLSIFAT
CKGFITLLTNGVLSVSGKVRNIVNMKLAHPWKLKDICDCLYISESLLKKKLKQEQTTFSQ
ILLDARMQHAKNLIRVEGSVNKIAEQCGYASTSYFIYAFRKHFGNSPKRVSKEYRCQRHT
GMNTGNTMNALAI