Protein Info for OKFHMN_01240 in Escherichia coli ECRC101

Name: ydeQ
Annotation: Uncharacterized fimbrial-like protein YdeQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF09160: FimH_man-bind" amino acids 27 to 171 (145 residues), 259.1 bits, see alignment E=4.7e-82

Best Hits

Swiss-Prot: 98% identical to YDEQ_ECOLI: Uncharacterized fimbrial-like protein YdeQ (ydeQ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to eco:b1502)

Predicted SEED Role

"mannose-specific adhesin FimH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (304 amino acids)

>OKFHMN_01240 Uncharacterized fimbrial-like protein YdeQ (Escherichia coli ECRC101)
MGKTISIKVLFGIYLLLMAGKVFAFSCNVDGGSSIGAGTTSVYVNLDPVIQPGQNLVVDL
SQHISCWNDYGGWYDTDHINLVQGSAFAGSLQSYKGSLYWNNVTYPFPLTTNTNVLDIGD
KTPMPLPLKLYITPVGAAGGVVIKAGEVIARIHMYKIATLGSGNPRNFTWNIISNNSVVM
PTGGCTVDSRNVTVNLPDFPGSAEIPLGVYCSSEQKLSFYLSGTTTDSARQVFANTAPDA
TKASGVGVSLMRNGKILATGENVSLGTVNKSKVPLGLSATYGQTGNKVSAGTVQSVIGVT
FIYE