Protein Info for OKFHMN_00260 in Escherichia coli ECRC101

Name: gspI
Annotation: type II secretion system minor pseudopilin GspI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details PF07963: N_methyl" amino acids 2 to 26 (25 residues), 23.1 bits, see alignment 4.2e-09 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 4 to 26 (23 residues), 20.6 bits, see alignment 2.9e-08 TIGR01707: type II secretion system protein I" amino acids 6 to 103 (98 residues), 76.7 bits, see alignment E=1.6e-25 PF02501: T2SSI" amino acids 40 to 117 (78 residues), 73.2 bits, see alignment E=1.5e-24

Best Hits

Swiss-Prot: 58% identical to GSPI_KLEPN: Type II secretion system protein I (pulI) from Klebsiella pneumoniae

KEGG orthology group: K02458, general secretion pathway protein I (inferred from 99% identity to ecf:ECH74115_B0008)

Predicted SEED Role

"General secretion pathway protein I"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>OKFHMN_00260 type II secretion system minor pseudopilin GspI (Escherichia coli ECRC101)
VKGQEGMTLLEVIVALVVFALAGMALMQASTQQAAGIGRMEEKVLAGWLADNQMVQLQLE
KTWPENGWGEKTISFAGTEWYLRWGGPDSDVPQPRSLEVEVRRTKEETSALVSLRSSVVR
E