Protein Info for OKFHMN_00185 in Escherichia coli ECRC100

Name: repA
Annotation: RepFIB replication protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF01051: Rep3_N" amino acids 99 to 210 (112 residues), 42.4 bits, see alignment E=4.7e-15

Best Hits

Swiss-Prot: 99% identical to REP10_ECOLX: RepFIB replication protein A (repA) from Escherichia coli

KEGG orthology group: None (inferred from 98% identity to eum:p1ECUMN_0001)

Predicted SEED Role

"RepFIB replication protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (325 amino acids)

>OKFHMN_00185 RepFIB replication protein A (Escherichia coli ECRC100)
VDKSSGELVTLTPNNNNTVQPVALMRLGVFVPTLKSLKNSKKNTLSRTDATEELTRLSLA
RAEGFDKVEITGPRLDMDNDFKTWVGIIHSFARHNVIGDKVELPFVEFAKLCGIPSSQSS
RRLRERISPSLKRIAGTVISFSRTDEKHTREYITHLVQSAYYDTERDIVQLQADPRLFEL
YQFDRKVLLQLKAINALKRRESAQALYTFIESLPRDPAPVSLARLRARLNLKSPVFSQNQ
TVRRAMEQLREIGYLDYTEIQRGRTKLFCIHYRRPRLKAPNDESKENPLPPSPAEKVSPE
MAEKLALLEKLGITLDDLEKLFKSR