Protein Info for OHPLBJKB_04387 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 458 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF06122: TraH" amino acids 30 to 378 (349 residues), 377.4 bits, see alignment E=4.4e-117

Best Hits

Swiss-Prot: 100% identical to TRAH1_ECOLI: Protein TraH (traH) from Escherichia coli (strain K12)

KEGG orthology group: K12072, conjugative transfer pilus assembly protein TraH (inferred from 99% identity to eoj:ECO26_p2-70)

Predicted SEED Role

"IncF plasmid conjugative transfer pilus assembly protein TraH" in subsystem Type 4 secretion and conjugative transfer

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (458 amino acids)

>OHPLBJKB_04387 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MMPRIKPLLVLCAALLTVTPAASADVNSDMNQFFNKLGFASNTTQPGVWQGQAAGYAYGG
SLYARTQVKNVQLISMTLPDINAGCGGIDAYLGSFSFINGEQLQRFVKQIMSNAAGYFFD
LALQTTVPEIKTAKDFLQKMASDINSMNLSSCQAAQGIIGGLFPRTQVSQQKVCQDIAGE
SNIFADWAASRQGCTVGGKSDSVRDKASDKDKERVTKNINIMWNALSKNRMFDGNKELKE
FVMTLTGSLVFGPNGEITPLSARTTDRSIIRAMMEGGTAKISHCNDSDKCLKVVADTPVT
ISRDNALKSQITKLLASIQNKAVSDTPLDDKEKGFISSTTIPVFKYLVDPQMLGVSNSMI
YQLTDYIGYDILLQYIQELIQQARAMVATGNYDEAVIGHINDNMNDATRQIAAFQSQVQV
QQDALLVVDRQMSYMRQQLSARMLSRYQNNYHFGGSTL