Protein Info for OHPLBJKB_04376 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: IS3 family transposase IS3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 147 to 160 (14 residues), see Phobius details PF13276: HTH_21" amino acids 53 to 102 (50 residues), 46.6 bits, see alignment 8.5e-16 PF00665: rve" amino acids 126 to 224 (99 residues), 96 bits, see alignment E=3.7e-31 PF13683: rve_3" amino acids 216 to 279 (64 residues), 37.9 bits, see alignment E=2.9e-13 PF13333: rve_2" amino acids 231 to 287 (57 residues), 72.9 bits, see alignment E=4.5e-24

Best Hits

Swiss-Prot: 100% identical to INSF5_ECOLI: Transposase InsF for insertion sequence IS3E (insF5) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to eco:b0372)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (288 amino acids)

>OHPLBJKB_04376 IS3 family transposase IS3 (Escherichia coli HS(pFamp)R (ATCC 700891))
MKYVFIEKHQAEFSIKAMCRVLRVARSGWYTWCQRRTRISTRQQFRQHCDSVVLAAFTRS
KQRYGAPRLTDELRAQGYPFNVKTVAASLRRQGLRAKASRKFSPVSYRAHGLPVSENLLE
QDFYASGPNQKWAGDITYLRTDEGWLYLAVVIDLWSRAVIGWSMSPRMTAQLACDALQMA
LWRRKRPRNVIVHTDRGGQYCSADYQAQLKRHNLRGSMSAKGCCYDNACVESFFHSLKVE
CIHGEHFISREIMRATVFNYIECDYNRWRRHSWCGGLSPEQFENKNLA