Protein Info for OHPLBJKB_04374 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Beta-lactamase TEM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00144: Beta-lactamase" amino acids 33 to 278 (246 residues), 117.6 bits, see alignment E=7.1e-38 PF13354: Beta-lactamase2" amino acids 48 to 261 (214 residues), 140.3 bits, see alignment E=6.2e-45

Best Hits

Swiss-Prot: 100% identical to BLAT_SALTI: Beta-lactamase TEM (bla) from Salmonella typhi

KEGG orthology group: None (inferred from 99% identity to bsn:BSn5_11680)

MetaCyc: 45% identical to PSE-4 beta-lactamase (Pseudomonas aeruginosa)
Beta-lactamase. [EC: 3.5.2.6]

Predicted SEED Role

"Beta-lactamase (EC 3.5.2.6)" in subsystem Beta-lactamase or Tn552 (EC 3.5.2.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.6

Use Curated BLAST to search for 3.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>OHPLBJKB_04374 Beta-lactamase TEM (Escherichia coli HS(pFamp)R (ATCC 700891))
MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYIELDLNSGKILESFRP
EERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYSPVTEKHLTDGMTVREL
CSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTM
PAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSALPAGWFIADKSGAGERGS
RGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGASLIKHW