Protein Info for OHPLBJKB_04359 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 36 to 58 (23 residues), see Phobius details amino acids 64 to 89 (26 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 187 to 205 (19 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to YUAM_ECOLI: Uncharacterized protein YuaM (yuaM) from Escherichia coli (strain K12)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>OHPLBJKB_04359 hypothetical protein (Escherichia coli HS(pFamp)R (ATCC 700891))
MYRVNHIMRTINEMSSYTPHMKVNRIAERLSKVQKISFCISVISFFLLAIITLTYGPFNT
KSNLSFISALSLYFINVIMGVTYLSVPVINTIKYIYNFKGEVVNELIYDIDSDEQHIEAL
LPYSLEELTYVSNCIQVRIPKIKSKCFLWGGGKTAIISILCLSYSAICIVNGGSIDGIFV
GETGDKIIVAIMFFILYTSLMNMFFKQKLLYLQNLKMIIDMTIKIKRNFT