Protein Info for OHPLBJKB_04330 in Escherichia coli HS(pFamp)R (ATCC 700891)

Annotation: Cryptic beta-glucoside bgl operon antiterminator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 PF03123: CAT_RBD" amino acids 3 to 56 (54 residues), 79.3 bits, see alignment E=1.6e-26 PF00874: PRD" amino acids 78 to 164 (87 residues), 89.9 bits, see alignment E=1.1e-29 amino acids 182 to 273 (92 residues), 65.2 bits, see alignment E=5.4e-22

Best Hits

Swiss-Prot: 100% identical to BGLG_ECOLI: Cryptic beta-glucoside bgl operon antiterminator (bglG) from Escherichia coli (strain K12)

KEGG orthology group: K03488, beta-glucoside operon transcriptional antiterminator (inferred from 100% identity to eco:b3723)

Predicted SEED Role

"Beta-glucoside bgl operon antiterminator, BglG family" in subsystem Beta-Glucoside Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>OHPLBJKB_04330 Cryptic beta-glucoside bgl operon antiterminator (Escherichia coli HS(pFamp)R (ATCC 700891))
MNMQITKILNNNVVVVIDDQQREKVVMGRGIGFQKRAGERINSSGIEKEYALSSHELNGR
LSELLSHIPLEVMATCDRIISLAQERLGKLQDSIYISLTDHCQFAIKRFQQNVLLPNPLL
WDIQRLYPKEFQLGEEALTIIDKRLGVQLPKDEVGFIAMHLVSAQMSGNMEDVAGVTQLM
REMLQLIKFQFSLNYQEESLSYQRLVTHLKFLSWRILEHASINDSDESLQQAVKQNYPQA
WQCAERIAIFIGLQYQRKISPAEIMFLAINIERVRKEH